Evde Mimar

2019daencokkullanilanbanyofayanstasarimlari
Banyo Dekorasyonu, Banyo Modelleri, Banyo Tadilatı, Ev Dekorasyonu

2019’un En Çok Tutulan Banyo Seramik Tasarımları

Evimizin her zaman yeni gibiymiş hissini vermesi için bazı basit yenilikler her zaman iyi bir çözüm olmuştur. Bu yeniliklerin büyük bir kısmının evin sürekli kullanılan kısımlarında olması her zaman daha başarılı olmuştur. Değişim yapılacak alanlardan biri de banyodur. Banyomuzda farklılık yaratacak değişimlerin en çok tercih edileni banyo seramiklerinin değiştirilerek eskisinden daha güzel bir tasarımla yer değiştirip yerine yeni banyo fayans modelleri koyup, bizi de bu değişiklikle farklı bir eve taşınmış hissi vermesidir.

İlginizi Çekebilir:

İşinizi Kolaylaştıracak Banyo Mobilyaları ve Dekorasyon Önerileri

Küçük Banyo Dekorasyonu ve Tadilatı Nasıl Yapılmalı Uzmanından Öneriler

1. Mat Kaplama Banyo Seramik Tasarımı

Mat kaplama banyo fayans modelleri oldukça popüler kullanımlardan biridir. Mat karolar yumuşak bir görünüme sahip olsa dahi oldukça güçlü bir estetik görünüme sahiptir. Duvar veya zemin için düşük parlaklıkta bir görünüm sağlıyor. Mat karoların estetik görünümü dışında bir diğer önemli özelliği ise bakımının oldukça kolay olmasıdır.

2. Ahşap Görünümlü Banyo Seramik Tasarımı

Ahşap kullanımını evimizin birçok kısmında görüyoruz. Son zamanlarda ise ahşap yerine ahşap görünümlü fayans kullanımına sıkça rastlıyoruz. Bunların bir örneği de banyolarımızda kullandığımız ahşap görünümlü banyo fayans modelleridir. Banyonuzda kullanacağınız ahşap görünümlü fayanslarla oldukça şık alanlar yaratabilirsiniz. Ahşap görünümlü fayanslar ahşap yüzey şıklığı sağlamasının yanı sıra suya dayanıklıdır ve ahşap zemine göre daha dayanıklıdır. Ahşap görünümlü fayansların suya dayanaklı olması banyolarda tercih edilmesinin sebeplerinden bir diğeridir.

3. Metalik Kenarlı Banyo Seramik Tasarımları

2019’un en çok tutulan banyo seramik tasarımlarından bir diğeri ise metalik kenarlı seramiktir. Metalik kullanım modası hiçbir zaman geçmeyecek tasarımlardan biridir. Bu estetik görünümlü parlak ve yansıtıcı tasarımı banyodaki seramiklerimizde kenarlık olarak kullanarak banyonuzda canlı bir görünüme ulaşabilirsiniz aynı zamanda metalik kenarlıklar kullandığınız alana mimari bir hava katmaktadır. Metalik kenar kullanımı alanınızı modernleştirmek için iyi bir seçenektir.

4. Geometrik ve Doğrusal Şekilli Banyo Seramik Tasarımı

Geometrik ve doğrusal şekilleri odalarda, tuvaletlerde, duş duvarlarında kullanabiliriz. Geometrik ve doğrusal şekillerin kullanımı duvarları vurgular ve estetik bir görünüm kazanmasını sağlar. Altıgen, balıksırtı ve chevron (zikzak şerit çizgiler) en çok kullanılan şekillerdendir. Duvarlarda ve zeminde kullandığımız bu dekoratif şekiller banyolarda oldukça şık bir görünüm sağlayarak, banyonuzun sadece bir banyodan daha fazlasıymış gibi durmasını sağlar.

5. Doğal Görünümlü Mermer Seramik Tasarımı

Evimizin her yerinde doğal unsurlar her zaman harika bir görünüm sağlamıştır. Mermer kullanımı da bu doğal unsurlardan biridir. 2019 senesinde doğal mermer görünümlü seramik banyo tasarımları yeniden moda olmaya başlamıştır. Bu doğal mermer görünümlü seramik banyo tasarımlarını banyomuzda kullanmanın en iyi yolu ahşap kaplama yer karoları ile beraber kullanmaktır.

6. Uzun & Dar Metro Banyo Fayansları

Bu yıl en çok tercih edilen tasarımlardan bir diğeri olan metro fayansları banyonuza oldukça modern ve şık bir görünüm katıyor. Metro fayans kullanımı banyolarımıza farklı bir boyut katıyor, uzun çizgileri sayesinde daha genişmiş algısı yaratıyor. Bu kullanımda daha çok açık renk tonların tercih edildiği görülmüştür. Eğer banyonuz küçükse ve banyonuzu daha geniş ve ferah göstermek istiyorsanız uzun&dar görünümlü metro fayanslarının açık renk tonlarını banyolarınızda kullanarak istediğiniz görünümü elde edebilirsiniz!

7. Grafik Döşeme Desenli Banyo Seramik Tasarımı

Hem zeminde hem de duvarda kullanabileceğiniz, kullandığınız alanı çok iyi vurgulayacak bir tasarımdır. Bu tasarımı kullanırken yumuşak tonlarla ya da sert tonları bir arada kullanarak bu karmaşıklığı cezbedici bir şekle dönüştürebilirsiniz. Bu tasarımın en büyük avantajlarından bir diğeri ise farklı desenleri bir arada kullanabilme durumundan ötürü size yaratıcılık fırsatı sağlamasıdır. Bu cesur ve renkli tasarımlar uzun bir süre daha trend olarak kalacak gibi duruyor.

2019 yılında banyolarda en çok tercih edilen banyo seramik tasarımlarını sizler için derledik ve nasıl kullanabileceğinize dair birkaç öneri sunduk. Umarız verdiğimiz örnekler ve öneriler işinize yarar ve banyolarınızda kullanma imkanı bulabilirsiniz!

ucuzevtadilatiicinpratikbilgiler
Aydınlatma, Banyo Tadilatı, Boya Badana, Ev Boyama, Ev Dekorasyonu, Güzel Evler, Mutfak Dekorasyonu, Salon Dekorasyonu

Ucuz Ev Tadilatı İçin Pratik Bilgiler

Eviniz aynen böyle hissettirmeli değil mi – EV gibi! Tasarım ve dekorasyon ne kadar bir zevk meselesi olsa da ,hemen hemen herkes evinin şık, rahat ve kişiliğinin bir yansıması olmasını ister. Özellikle de uzun yıllardır aynı evde yaşıyorsanız ya da yeni bir evin satın aldıysanız, evinizi yenileme ve hayallerinizdeki dekorasyonda olmasını istemenizden doğal hiç bir şey yoktur. Ancak, yenileme her zaman yüksek rakamları karşımıza çıkarır. Yeni bir mutfak dolabı seti binlerce Türk lirasına mal olacak. Yeni tezgah, banyo yenileme veya parkelerin değişmesi derken aile bütçemiz sarsılabilir. Peki tüm bunları düşününce evimizi yenilemekten vaz mı geçmeliyiz? Tabii ki hayır! Sizler için bütçenizi fazla zorlamayacağınız ama evinize bambaşka bir atmosfer kazandırabileceğiniz tadilat fikirlerimize mutlaka göz atın.Önemli olan araştırmanızı yapmak ve aceleci olmamak. İşte sizi yeniden evinizi cennete dönüştürmek için ilham verecek birkaç yeni fikir..

mimari-gorsellestirme-banner

Mutfaklar ve Salonlar

Mutfağınızın tasarımını değiştirmek istiyorsanız ve size çıkaracağı maliyet fazlaysa size önereceğimiz bu şık duran ve mutfağınıza bambaşka hava katacak ipuçlarına mutlaka göz atın.

Yüzeyler ve Armatürler

Mutfağınızdaki cihazlarda  ya da armatürlerinizde paslanmaz çelik görünümlü yapışkan kağıtlar kullanın. Bu size astronomik fiyat etiketi olmadan modern bir görünümü sağlayacaktır. Cihazınız,paslanmaz çelik bir görünüme sahip olacak ve yenilenmiş bir cihaz olarak sizi mutlu edecek. İnanın kimse farkı bilemeyecek.

Mutfak dolaplarınızı boyayın

Eski görünümlü dolaplar mutfağınızda kasvetli bir hava yaratabilir. Onları değiştirmekten masraflı olacaksa,boyamanızı öneriyoruz.Dolaplarınızı boyayacak kadar maceracı değilseniz, mutfakta bir dolap kapısını camdan değiştirmeyi düşünün; böylece örneğin servis parçalarınızı ve özel takımlarınızı bu bölümlere koyabilirsiniz.

Yeni prizler ve kapaklar takın. Elektrik malzemeleri satan yerlerde çok uygun fiyatlara beyaz, siyah, renkli ,hatta desenli prizler ve kapaklar bulabilirsiniz.

Duvarlarınız Yenilensin

Evinizde yeni bir boyama bazen çok masraflı olabilir. Sizin istediğiniz düz renk bir boya da olmayabilir. Bu koşullarda size çıkarılabilir duvar kağıtlarını önerebiliriz.Hem uygulaması kolay hem de maliyeti çok azdır.Tek bir duvarınızı dahi yaparak odalarınızı canlandırabilirsiniz.

Duvarlarınızı mobilyalarınıza uygun renklerde boyamakta yenilenme hissi verecektir. Badana ve boya konusunda kendinize güvenmiyorsanız evdemimar sayfamızdan fiyat teklifi de alabilirsiniz.

Tablolar asın ya da kendiniz tasarlayın

Bir odanın görünümünü basitçe bir sanat eserini ya da resimlerinizi asarak ta değiştirebilirsiniz. Duvarlara delik açmadan önce duvarınızı ölçün . Alternatif olarak,duvarınızda delikler açmadan da yapışkanlarla da asabilirsiniz. Tablolar size maliyetli gelebilir , bunun yerine kendiniz tasarlayın ve duvarlarınızı süsleyin.

Koridorlar ve Antreler

Evinizin girişi sizin aynanız gibidir. Bu yüzden aslında kapıyı açtığınızda görmek istediğinizi antrenize yerleştirmelisiniz.

Kartonpiyer yapıştırılan kalıplar ile süpürgelik kaplamasını yapabilirsiniz. Bütçenize bağlı olarak, ahşap kaplama ile şık görünebilir ya da beyaz kaplama üzerinde boyayarak bir ekstra bir karakter verebilir.

Işıklandırmalarınızı değiştirin

Geliştirilmiş aydınlatma ampullerinden evinize yayılan “ışık spektrumunun” uygun olduğundan emin olun. Oturma odası gibi bolca vakit geçirdiğiniz alanlarda sarı / kırmızı bir ton altı yayan yumuşak ampuller uygun olacaktır.. Ev ofisiniz ya da kütüphaneniz gibi çalışma alanlarında mavi ton altı yayan parlak ampuller dikkatinizi arttırmada yardımcı olacaktır.

Aynı şekilde yeni bir aydınlatma planı maliyetli olacağı için kendiniz tasarlayabilir ya da bütçenize uygun şık bir ürün mutlaka bulabilirsiniz.

Daha fazla ayna asın

Daha fazla ayna asarak, evinizin içinde parlayan ışığı arttırabilirsiniz. Aynı odaya iki ayna asabilirsiniz, bunları zıt duvarlara yerleştirin; Bu odanızın daha büyük görünmesini sağlayacaktır. 

Kapı kolları ve menteşeler

Kapı kollarını ve menteşelerinin değişimi için sizden oldukça yüksek fiyatlar talep edilebilir. Aslında var olan bu küçük parçaların kurulumu hızlı ve kolaydır.. Emin olun kendiniz yapabilirsiniz. Bunlar muazzam bir fark yaratan son dokunuşlardır ve aynı hatlar boyunca evinizdeki dolaplar içinde  yeni parçalar satın alarak yapabilirsiniz.

Banyonuzu yenileyin

Bir banyo tadilatını ödeyebilecek bir konumda değilseniz,ilk olarak  duş kapınızı ve armatürlerinizi değiştirmeniz gerekir. Aynı şekilde yeni bir banyo dolabı almak oldukça masraflı olacağı için dolaplarınızı istediğiniz renkte boyamanız bambaşka bir ev hissiyatı verebilir.

Aynı şekilde banyo mobilyalarınızı değiştirmeden yeni bir ayna ve ışıklandırma da banyonuzda yeniliği çağrıştıracaktır.

Banyo seramikleri nemli ortamdan dolayı daha hızlı deforme olabilirler. Zararlı kimyasallar içermeyen yüzey boyaları ile desenli bir seramik dahi yapabilirsiniz. Yeter ki banyonuzda nasıl bir zemin istediğinize karar verin.

Zemini değiştirmeniz mi gerekiyor? Eski katları güncelleyin. Aşınmış, eski zeminler bütün bir odanın tonunu belirleyebilir, ancak zemini yeniden zımparalamak ve bitirmek yeteneklerinizin ötesinde olabilir.Bir çok ev dekorasyon mağazasında bulabileceğiniz zemin boya ve kolay kaplamalar ile evinizde hızlı ve ekonomik bir yenilenme sağlayabilirsiniz.

Evinizi tamir etmek pahalı ya da zor olmak zorunda değil; Sadece sizin evinizde neler görmek istediğiniz çok önemlidir.Tadilata bir çok para harcayıp istediklerinizi alamayabilirsiniz. Bu yüzden önce ne istediğinize karar vermelisiniz. Daha fazla bilgi ve tadilat konusunda mimarımızdan ve ekibimden yardım almak için Evde Mimar sayfamızı inceleyebilir ve bize ulaşabilirsiniz.

evdenevenakliyatoncesindeevinizintadilatındaneleredikkatetmelisiniz
Anahtar Teslim Tadilat, Banyo Tadilatı

Evden Eve Nakliyat Öncesi Evinizin Tadilatında Nelere Dikkat Etmelisiniz?

Yaşadığımız alanın belirli bir düzen içerisinde olması ve yaşamaktan keyif alacağımız bir yapıda olması oldukça önemlidir. Özellikle bir evden başka bir eve taşınırken iç dekorasyonu ve alt yapısının doğru bir şekilde yapılması gereklidir. Eğer sıfır bir eve taşınmıyorsanız, taşınma öncesinde tadilat işlemlerini yaptırmanın yanı sıra boya badana gibi dekorasyon çalışmalarının yapılması da daha kolay olacaktır. Ancak bu noktada yapılacak olan tadilat işlemlerinin belirli bir sıra ve düzen ile yapılması hayati bir öneme sahiptir. Bu yazımızda sizlere nakliyat öncesi yeni evde hangi tadilat işlemlerinin yapılması gerektiğini ve bu tadilat işlemlerini yaptırırken nelere dikkat etmeniz gerektiğini detaylı bir şekilde anlatmaya çalışacağız.

banner

Nakliyat İşlemi Öncesinde Hangi Hazırlıklar Yapılmalıdır ?

Evden eve nakliyat işlemlerinde planlı ve programlı olmak hayati bir öneme sahiptir. Nakliyat haftası öncesinde yeni evinizdeki tüm tadilat işlemlerinin tamamlanmış olması gereklidir.  Bu noktada tadilat işlemleri için anlaşacağınız firmanın ya da ustanın hazırlanılan plana uygun çalışmalıdır. Eğer işlemler zamanında bitirilmez ise tüm nakliyat sürecinde gecikmeler yaşanabilir. Anlaşacağınız ustaya ya da firmaya bitiş süresi konusunda sözleşmeye madde ekletebilir ve bu gecikmelerden kaçınabilirisiniz.

Eşyaların hazırlanması aşamasında eşya listesi hazırlamak yükünüzü oldukça hafifletecektir. Bu eşya listesi içerisinde kolilerinizi numaralandırabilirsiniz. Böylece hiç bir eşyanız kaybolmadan tüm nakliyat sürecini sorunsuz bir şekilde tamamlayabilirsiniz.

nakliyatoncesievhazirliklari

Taşınacağınız Evin Tadilatı ve Tadilat Ustası Seçimi

Her şeyden önce hangi ustalar ile çalışacağınızı belirlemelisiniz. Bunun için yeni evde yapılacak olan tadilat işlemlerini bir liste haline getirmeniz süreci oldukça kolaylaştıracaktır. Yeni evinizde detaylı bir incelemenin ardından eviniz için doğru tadilat ustasını aramaya başlayabilirsiniz.

Dilerseniz sizin için hazırladığımız 7 Adımda Anahtar Teslim Tadilat videomuzu izleyerek tadilat hakkında daha detaylı bilgilere ulaşabilirsiniz.

Usta seçimi yapmadan önce bir çok usta ile görüşmek ve ücretleri, işlemleri ve süreyi oldukça net bir şekilde konuşmalısınız. Yapılmasını istediğiniz işlemleri açık ve detaylı bir şekilde anlatarak tadilat sürecinde yaşanabilecek sorunları ortadan kaldırabilirsiniz. Bunlara ek olarak ustanın daha önceden yaptığı işleri ve referanslarını da öğrenebilirsiniz.

tadilatoncesiustaseciminasilyapilmalidir

Özellikle tadilatın evden eve nakliyat öncesinde kesinlikle bitirilmesinin önemli olduğunu usta ile paylaşmalısınız. Bunlara ek olarak hangi malzemelerin kullanılacağı ve bu malzemelerin maliyetlerini öğrenerek yeni eve nakliyat bütçenizi düzenleyebilirsiniz.

Dilerseniz Evde Mimar olarak sizin için hazırladığımız tadilat fiyatları içeriğimizi inceleyerek daha detaylı bilgilere ulaşabilirsiniz : Ev Tadilatı Fiyatları Ne Kadardır – Tadilat Ne Kadar Tutar ?

Tadilat İşlemlerinizi Usta İle Planlayabilirsiniz

Nakliyat gününe kalan süreye göre tadilatta hangi bölümlerin öncelikli olacağı hakkında anlaştığınız tadilat ustası ile fikirlerinizi paylaşabilirsiniz. Özellikle banyo tadilatı işlemlerinin önceden bitirilmesi geri kalan süreçte daha rahat çalışılmasını sağlayacaktır. Banyo ve mutfak tadilatlarında çıkabilecek küçük problemlerin çözülmesi diğer tadilat işlemlerine göre daha uzun sürecektir.  Haftalık iş planlamasını usta ile belirledikten sonra belirli aralıklarda yapılan işler hakkında bilgilendirme isteyebilirsiniz. Bu bilgilere göre nakliyat gününe kadar karşınıza çıkacak sorunlara çözümler üretebilirsiniz.

tadilatvenakliyatislemleriniplanlamak

Banyo Tadilatında Dikkat Edilmesi Gereken Konular

Taşınmak üzere olduğunuz evin tadilatında en önemli bölümlerden birisi banyo tadilatıdır. Temiz su tesisatının doğru bir şekilde bağlanması, kullanılan boruların malzeme kaliteleri en çok dikkat etmeniz gereken konuların başında gelmektedir. Anlaşacağınız tadilat ustasından banyo tadilatı sırasında daha dikkatli ve titiz bir şekilde çalışmasını isteyebilirsiniz.

Fayans ve derz çalışmaları banyonuzun genel görünümünün güzel ve estetik olabilmesi için titizlikle çalışılması gereken bölümlerin başında gelmektedir. Fayans seçiminizi dilerseniz ustalar ile birlikte rahatlıkla yapabilirsiniz. Bu noktada kendinizi rahatlıkla ifade edebilmeniz ve ustaların görüşlerinize önem vermesi oldukça önemlidir.

banyotadilatiplanlamasi

Banyo tadilatı hakkında detaylı bilgi almak için Banyo Tadilatı Sırasında Nelere Dikkat Etmeliyiz içeriğimizi inceleyebilirsiniz.

Nakliyat gününe tüm işlemlerin yetişebilmesi için herhangi bir sorun yaşandığında ustanın size bildirmesi ve çözüm için öneriler sunması da süreci daha etkili bir şekilde yönetilmesine yardımcı olacaktır.

Mutfak Tadilatında Nelere Dikkat Edilmelidir ?

Mutfakta yapılacak olan tadilat işlemleri diğer bölümlere göre daha uzun sürebilmektedir. Aynı zamanda programa uygun bir çalışma planı ve uygulaması ile eve taşınmadan önce mutfak tadilat işlemleri bitirilebilmektedir. Ancak bu noktada sorunlu olan bölümlerin ve beyaz eşyaların yerlerinin tespit edilmesi büyük bir öneme sahiptir. Ardından mutfağınızda tercih edeceğiniz zemin, mutfak dolabı ve duvar malzemelerini tadilat ustası ile birlikte seçebilirsiniz.

Mutfak zeminlerinde yoğunlukla fayans tercih edilmektedir. Bunun nedeni parlak ve hijyenik bir görünüme sahip olmasıdır. Bunun yanı sıra ahşap zeminlerle ise mutfağınıza daha estetik bir görünüme sahip olabilirsiniz.

tadilattafayanssecimi

Dilerseniz mutfak zemini için fikir alabileceğiniz Mutfak Fayans Modeleri ve Fiyatları içeriğimizi inceleyebilirsinizi.

Mutfak dolaplarınız için doğru ölçüler alınması ve bu ölçülere göre üretim yapılması önemlidir. Kullanışlı ve estetik bir mutfak dolabı için detaylı bir araştırma yaparak hangi malzemeyi kullanacağınız hakkında önceden bir fikriniz olabilir. Böylece seçim süreci daha kısa sürecek ve nakliyat öncesi mutfak tadilatı işlemlerine hızlıca başlanabilecektir.

mutfaktadilatindamutfakdolabiseciminasilyapilmalidir

Mutfak dolabı modellerini Evinize Özel Mutfak Dolabı Modelleri ve Tasarımları içeriğimizi inceleyebilirsiniz.

Yeni Evinizin Tadını Çıkarmayı Unutmayın

Evden eve nakliyat süreci oldukça zorlu ve stresli geçebilmektedir. Özellikle tadilat veya taşıma sırasında yaşanabilecek sorunlar oldukça can sıkabilir. Bundan dolayı tüm taşınma ve nakliyat işlemleri tamamlandıktan sonra yepyeni evinizin tadını çıkarmayı kesinlikle unutmayın.

Bu içeriğimizde sizlere evden eve nakliyat öncesinde evinizin tadilatında nelere dikkat etmeniz gerektiğini ve tadilat sırasında hangi konulara önem vermeniz gerektiğini detaylı bir şekilde anlatmaya çalıştık. Evde Mimar olarak evinizi güzelleştirmek ve hayalinizdeki eve kavuşmanız için daima hazırız. Aklınızdaki soruları dilediğiniz zaman bize iletebilir, öneri ve görüşlerinizi ekibimiz ile rahatlıkla paylaşabilirsiniz.

kucukbanyodekorasyonu
Banyo Dekorasyonu, Banyo Modelleri, Banyo Tadilatı

Küçük Banyo Dekorasyonu ve Tadilatı Nasıl Yapılmalı Uzmanından Öneriler

Ülkemizdeki banyolar genellikle beklediğimizden ve ihtiyacımızdan küçük olarak tasarlanmaktadır. Bu nedenle küçük banyo dekorasyonu yapma konusunda ev sahipleri hem pek çok sorun ile karşılaşıyoruz. Biz de bu içeriğimizde sizlere küçük banyo dekorasyonu ile ilgili hem bilgiler verip hem de örnekler ile dekorasyonu daha iyi bir biçimde anlamanıza yardımcı olmaya çalışacağız. Hazırsanız başlıyoruz. 🙂

banner2

Küçük Banyo Dekorasyonu ile İlgili Kullanım Örnekleri ve Önerileri

Banyonuzu güzelleştirmek için sizlere küçük banyo dekorasyonu ile ilgili öneriler derledik. Umarız sizin için harika olacak çalışmaları buradan takip ederek evinizi daha iyi bir yer haline getirebilirsiniz.

İncelemeniz gereken içerik: Banyo tadilatı ne kadar tutar?

Küçük Banyolarda Köşeleri Doldurun

Eğer küçük bir banyonuz varsa köşeleri iyi bir şekilde kullanarak sağlam bir dekorasyon elde edebilirsiniz. Bunun için banyonuzun her köşesine sizin için gerekli olan gereçleri veya dolapları yerleştirebilirsiniz.

Duş Bölümünü Bir Perde ile Ayırın

Küçük bir banyoya sahipseniz bunu bölümlere ayırarak yönetebilirsiniz. Özellikle duş bölümü sizin için ayırabileceğiniz hoş bir alan olabilir. Bunun için duş bölümü ile banyo bölümünü perde veya özel paravanlar, uygulamalar ile ayırabilirsiniz.

Gömme Bölümler Fark Yaratır

kucukbanyogommeraf

Küçük banyolar için eğer altyapı sisteminiz uygunsa gömme bölümler oluşturabilirsiniz. Bu çalışma derinlik algısı yaratacağından banyonuzun daha büyük gözükmesine yardımcı olacaktır.

Lavabo Etrafını Açın

Banyonuzu ne denli sade ve minimalist bir şekilde dizayn ederseniz o kadar başarılı bir çalışma yürütmüş olursunuz. Sade görünümler her zaman için büyük ve geniş algısını uyandırıcı etkilere sahiptirler. Özellikle el yıkama bölümünün etrafının sadeliği küçük banyolar için minimalist algı da size yardımcı olacaktır.

Büyük Desenleri Tercih Edin

buyukdesenlerkullanimi

Fayanslar ve banyonuzun diğer süslemeleri büyük desenli olmalıdır. Seçeceğiniz desenlerin büyük olmasına ve banyonuzu büyük göstermesine dikkat etmelisiniz. Ufak detayların güzel bir dekorasyonun temelleri olduğunu unutmayın.

İçerik önerisi: Banyo dekorasyonu

Kapısız Duşakabinler Deneyin

kapisizdusakabinler

Duşakabinlerinizin kapısız olması alanı iyi kullanmanız için elinizi güçlendirecektir. Kapının yer kaplamadığı duşakabinler açılır kapanır bir şekilde olduğunda hareket alanınızı kısıtladığı için sizi rahatsız edebilmektedir. Bunun için duşakabin seçimlerinizde banyonuzu büyük göstermek istiyorsanız kapısız modelleri tercih etmelisiniz.

Duvarlara İşinizi Yarayacak Raflar Yerleştirin

Duvarlara sıralı bir şekilde raflar yerleştirerek banyonuzda kendiniz için ekstra kullanım alanları oluşturabilirsiniz. Bu rafların sade bir şekilde seçilmesine ise özellikle dikkat etmelisiniz.

Raflar Gömülü Olabilir

Rafları sıralama yöntemi ile yerleştirmenin yanında gömülü bir biçimde de raf ve dolapları yerleştirebilirsiniz. Gömülü şekilde yerleştirilecek raflar depolama alanınızı fazlalaştıracağı için küçük banyonuzda sizin için daha fazla yer kalmasına yardımcı olacaktır.

Beyaz ve Beyazın Tonları Sadelik Barındırır

beyazbanyodekorasyonuvetasarimi

Küçük banyoların dizayn ederken renklerinizin her zaman beyaz ve beyazın tonları olması beklenir. Beyaz renk sadeliği ve temizliği yansıtırken mekana ferahlıkta kattığı için küçük banyolarınız için güzel bir ortam sağlanmasına ön ayak olacaktır.

İlgili içerik: Yeni nesil banyo dekorasyonları

Az Model Az Desen

beyazbanyodekorasyonsadetasarim

Ne kadar az desen ve ne kadar az model ile birlikte çalışırsanız banyonuzu o kadar fazla sadeleştirebilirsiniz. Sadelik istiyorsanız tek bir model (tek bir dekorasyon aklı) ile hareket etmelisiniz. Yalnızca banyonuz değil evinizin tümü aynı dekorasyon aklı ile dizayn edilmelidir.

Konu ile ilgili detaylı bilgi için: Dekorasyon fikirleri

Çift Taraflı Benzerlik Metodu

simetrikbanyodekorasyon

Ev dekorasyonu veya banyo dekorasyonu, hangisini yaparsanız yapın çift taraflı benzerlik metodu ile harika işler çıkartabilirsiniz. Çift taraflı benzerlik çalışması odanın sağı ile solunun birbirinin aynısı veya benzerinin dizayn edilmesi şeklinde oluşur. Küçük banyolarınız için büyük gözükmesine yardımcı olacağı gibi dekorasyon için de hoş bir görüntü sağlayacaktır.

Küçük Banyo Dekorasyonu için Ayna Kullanımı

Küçük banyolarınız için en ideal dekorasyon önerilerinden biri de hiç şüphesiz ayna kullanımıdır. Aynaları iyi bir şekilde kullanarak banyoyu büyük gösterebilirsiniz. Ayna kullanımı küçük odalar ve banyolar için kurtarıcı olabilmektedir.

Geometrik Şekiller ve Desenler

Banyonuzu belli bir şekle sokmak istiyorsanız geometrik desenler işinize yarayacak çalışmalar olarak göze çarpmaktadır. Altıgen şekiller, üçgen, dörtgen desenler banyonuzu büyük göstermede işinize yarayacaktır.

Raflar Zayıf ve Uzun Olmalı

Küçük bir banyoyu dizayn ederken, dekorasyon yaparken uzun olmasının yanında zayıf olacak, ince olacak rafları da tercih etmelisiniz. Banyo raflarınız ne kadar zarif gözükürse o kadar harika bir dekorasyon elde edersiniz.

Modern Bir Banyonuz Olsun İstiyorsanız

Modern tarz küçük alanlarda uygulanabilecek tarzlardan biridir. Banyonuz küçükse ve modern tarzda döşemek istiyorsanız oldukça açık tonları ya da gri renkleri tercih ederek başlayabilirsiniz! Bunun yanında lavabonuzun arkasında ki duvarda mermer kullanmak harika bir fikir olabilir. Açık renklerde mermerler kullanarak banyonuzun geniş gibi görünmesini sağlayabilirsiniz hem de modern bir tarz yakalamış olursunuz.Banyonuzda kullandığınız aydınlatmanın yanında duşakabininizin yanına ya da lavabonuzun olduğu yerlere spot ışıklar ekleyebilirsiniz. Spot ışıkları kullanmanız oldukça hoş bir görüntüye sebep olacaktır.

Banyo Tadilatı Fiyatları

Banyonuzu dekore etmeden önce tadilata ihtiyacının olduğunu düşünüyorsanız, dekore etmeden önce tadilatını yaptırmanız sizin için iyi olacaktır. Banyo tadilatının fiyatları banyonuzun boyutuna,ihtiyacı olan tadilatın fazlalığına ve malzemesine bağlı olarak değişmekle birlikte çiziminin yapılması ve tadilatının yapılması on sekiz bin ile yirmi beş bin olarak hesaplanabilir. Çizim yaptırmayacak, sadece tadilat yapılacak ise ortalama on iki bin ile yirmi bin Türk Lirası arasındadır.

Banyo Tadilatı Kaç Gün Sürer

Banyonuza tadilat yaptırmayı düşünüyorsanız ve kaç gün süreceği hakkında bilgi sahibi olmak istiyorsanız içeriğimiz tam size göre! Banyo tadilatının süresi, tadilat yapılacak olan banyonun ihtiyacına, büyüklüğüne ve isteğinize göre şekillenir ancak ortalama bir banyoya tamamen tadilat yapılması on ile onbeş gün arasında değişir. Bu süre onbeş ile kırk güne çıkabileceği gibi, on ile onbeş gün arasına da inebilir.

Bu içeriğimizde sizlere küçük banyo dekorasyonu ile ilgili olarak bilgiler sunmaya çalıştık. Umarız sizler için faydalı olmuştur. Siz de konu ile ilgili olarak bizlere merak ettiklerinizi sorabilir, soru ve görüşlerinizi dilediğiniz an bizlere aktarabilirsiniz.

İlgili İçerik:Banyo Seramik Modelleri

İlgili İçerik: İlham Alınacak Banyo Modelleri

İlginizi çekebilir: Banyo dolap modelleri

İlginizi Çekebilir: Yeni Nesil Banyo Dekorasyonları 

duşakabin çeşitleri, fiyatları ve modelleri
Banyo Dekorasyonu, Banyo Modelleri, Banyo Tadilatı, Ev Dekorasyonu, Uygulama Örnekleri

Duşakabin Çeşitleri, Fiyatları ve Modelleri

Dekorasyon anlayışının gelişmesiyle birlikte banyoda kullanılan duş perdeleri yerini şık ve kullanışlı duşakabinlere bıraktı. Hem etrafın ıslanmasını önleyen hem de banyoda zarif ve şık bir görüntü sağlayan duşakabinler artık her evde sıklıkla rastlayabildiğimiz banyo dekorasyon ürünüdür.  Duşakabinler, dar banyolarda dahi kurulumunun yapılabilmesi, geniş alanlara ihtiyaç duymaması, ayrıca küvet ya da jakuziye göre daha kolay temizlenebilmesi gibi artılarıyla konforu ve hijyeni bir arada sunmaktadır. Duşakabinler, banyo zeminine su sıçratmadan ve içerideki sıcağı koruyarak banyo yapmamızı sağlayan, oldukça kullanışlı ürünlerdir. Küvet ve jakuzi gibi büyük metrekarelere gereksinim duymaması, suyu alanına hapsederek banyoda ıslak zemin sorunu yaratmaması sebebiyle çokça tercih edilmektedir. Teknolojinin gelişmesiyle beraber duş alırken müzik dinlemenize ya da farklı su ayarları ile duş zevkinizi arttırmanıza olanak tanıyan modellerinin yanında daha sade ve işlev odaklı tasarımlara sahip çok geniş yelpazede duşakabin modelleri vardır.

banner2

Etkileyici Duşakabin Çeşitleri

Duşakabin çeşitleri arasında genellikle buzlu, çizgili, füme, desenli ya da şeffaf camlar tercih ediliyor. Mika (polistren) ve tamperlenmiş duşakabin camları tercih ederseniz duşakabininizi yıllarca güvenle ve sağlıkla kullanabilirsiniz. Ayrıca yerden tavana uzanan cam kabinler, en şık duşakabinler arasında yer alır. Duşakabin camlarının yerden tavana kadar yükselen bir tasarımda olması, duş esnasında oluşan buharın bu alanda kalmasını sağlar. Dışarı çıkmasını banyoyu buhar yapmasını engeller. Aynı zamanda bu buhar içeride kalarak bu alanın daha sıcak olmasını sağlar. Duşakabin alırken banyonun boyutuna dikkat etmelisiniz. Küçük banyolar için, cam duşakabin çeşitleri tercih ederseniz banyonuz olduğundan daha geniş görünür. Modern cam duşakabin modelleri diğer tasarımlardan farklı olarak oldukça az yer kaplayan, çok ince ve zarif tasarımlardır.

En çok tercih edilen duşakabin çeşitleri ;

  • Buzlu Cam Duşakabin
  • Normal Cam Duşakabin
  • Mika Duşakabin
  • Teknesiz Duşakabin
  • Tekneli Duşakabin
  • Oval Cam Duşakabin
  • Kare Cam Duşakabin
  • Desenli Duşakabin

Banyo dekorasyonunuz için en ideal duşakabin çeşidini belirlerken örneklerden yararlanmanızda fayda vardır. Farklı duşakabinlerin kullanıldığı banyo dekorasyon örneklerini inceleyerek eviniz için bir çok ilham toplayabilirsiniz.

Duşakabin Fiyatları

Banyo dekorasyonunuzu değiştirmek istediğinizde tercih edebileceğiniz farklı ürün seçenekleri bulunmaktadır. Bunlar arasında yer alan duşakabinler özellikle dilediğiniz alanda yapılacak olan uygulama sayesinde daha kullanışlı alanlara sahip olmanızı sağlamaktadır. Duşakabin seçerken kullanıcıları banyolarına uygun şekilde tercih yapmaları gerekir.  En uygun duşakabin çeşitlerini seçerken, estetik özellikleri haricinde karar verirken dikkat etmeniz gereken bir diğer konu ise ürünün dayanıklılığıdır. Uzun vadede kullanım rahatlığı sunacağından emin olduğunuz bir ürün en doğru seçim olacaktır. Daha ayrıntılı bilgi için Duşakabin Seçerken Nelere Dikkat Edilmeli yazımızı okuyabilirsiniz.

Duşakabin fiyatları yapılacak uygulamanın özelliğine göre değişiklik göstermektedir. En doğru duşakabin fiyatları keşif yapıldıktan sonra, model ve ölçüler belirlendirkten sonra verilebilir. Evde Mimar olarak sizin için ortalama duşakabin fiyatlarını bir araya getirdik. Buraki ortalama fiyatları inceleyerek bütçenizi yaptırmak istediğiniz duşakabine uygun bir şekilde düzenleyebilirsiniz.

Duşakabin Çeşitleri Duşakabin Türü 80×80 Cm Duşakabin Fiyatları 90 x 90 Cm Duşakabin Fiyatları 100 x 100 Cm Duşakabin Fiyatları 100 Cm Üstü Duşakabin Fiyatları
Camlı Duşakabin Tekneli 1.100 TL – 1.200 TL 1.250 TL – 1.400TL 1.350 TL – 1.550 TL 1.700 TL +
Teknesiz 950 TL – 1.100 TL 1.150 TL – 1.300TL 1.250 TL – 1.450 TL 1.500 TL +
Plastik Duşakabin Tekneli 750 TL – 850 TL 850 TL – 950 TL 950 TL – 1.150 TL 1.250 TL +
Teknesiz 550 TL – 750 TL 750 TL – 850 TL 850 TL – 950 TL 1.000 TL +

Bu tabloda bulunan fiyatlar temsili fiyatlardır.

Duşakabin fiyatları 450 – 1,700TL arasında değişiklik göstermektedir. Gelişen teknolojiyle beraber daha özel bir duşakabin isterseniz bu fiyat aralığı 5,000TL ye kadar çıkmaktadır. Duşakabin fiyatı ve performansı bakımından uzun vadede kullanılacak bir üründür. Her bütçeye göre değişen duşakabin fiyatları arasından bütçenize en uygun seçimi yapabilmek için farklı duşakabin modellerini inceleyebilirsiniz. Özellikle duşakabin fiyatları konusunda yapılacak karşılaştırmalar en uygun fiyat seçenekleri üzerinden tercih yapılmasını sağlamaktadır. Model belirledikten sonra yapılacak karşılaştırmalar, modeller arasındaki farklar incelenerek kişinin bütçesine uygun şekilde tercih yapması sağlanabilir.

Duşakabin Modelleri ve Örnekleri

Bir banyonun tüm görünüşünü değiştirecek kadar şık duşakabin modelleri bulunmaktadır. Duşakabin modelleri  oval, dikdörtgen, kare, asimetrik sauna sistem, teknesiz, akordeon katlanır, iki duvar arası modelleri olarak sınıflandırılabilir. Farklı şekillerde hazırlanmış olan duşakabin çeşitleri özellikle kullanıcıların konumlandıracağı alana göre en uygun seçeneği belirlemesi sayesinde sorunsuz kullanım imkanı elde edilmesini sağlamaktadır. Kullanılan malzeme seçenekleri uzun yıllar boyunca kullanım imkanı elde edilmesi için etkilidir. Yuvarlak ve oval modelleri, banyo ortasına yerleştirirseniz kullanım alanınızın daha geniş görünmesini sağlayabilirsiniz. Kare ve dikdörtgen modellerin farklı desen ve renkleri bulunmasının yanı sıra, hemen her banyoya uygun olması sebebiyle de en sık tercih edilen modellerdir. Kare modellerin kulplu ve sürgülü, kayar kapılı ve iki duvar arası gibi seçenekleri banyonuzun konumuna göre ebatlandırılarak monte edilir. Banyolarda konforuna ve hijyenine önem verenler duş tekneleri tercih etmelidirler. Her türlü alana, zevke ve kullanışına göre küvet çeşitleri bulunur. Duşakabin modelleri için aşağıdaki harika görselleri inceleyebilirsiniz.

İlginizi çekebilir: Son yılın popülerleşen duşakabin modelleri 

Duşakabin setleri seçiminde göstereceğiniz ihtimam ile en uygun banyo dekorasyonu seçiminde hedefi on ikiden vurabilir ve muhteşem bir banyoya sahip olabilirsiniz.

Bu konuyla ilgili şu içeriklerimiz de ilginizi çekebilir:

Teknesiz Duşakabin Modelleri ve Kullanım Önerileri

Dikdörtgen Duşakabin Modelleri ve Kullanım Önerileri

banyoseramikmodelleriveornekleritasarim
Banyo Dekorasyonu, Banyo Modelleri, Banyo Tadilatı, Ev Dekorasyonu, Güzel Evler

Banyo Seramikleri Modelleri ve En Harika Örnekler (50 Enfes Öneri ile)

Banyolar evin en harika alanları arasında yer alır. Keyif veren ve insanın en fazla mutlu olması gereken alanları, bölgeleri arasında yer alırlar. Bizler de bu içeriğimizde sizler için en güzel banyo seramikleri modelleri ve örnekleri derlemesi gerçekleştirdik. Örnekleri sizlere derlemenin yanında iç mimarlardan en harika önerileri de derleyerek banyo dekorasyonu için rehber olmaya çalıştık. Umarız beğenirsiniz. Hazırsanız harika içeriğimize başlıyoruz 🙂

Banyo Seramikleri Modelleri ve Örnekleri

Banyo seramikleri banyo dekorasyonu sırasında dikkat edilmesi gereken en önemli parametrelerden biridir. Eğer düzgün bir dekorasyon yapmak istiyorsanız o dekorasyon aklınıza uygun banyo seramikleri seçmelisiniz. Bunun için de içeriğimizin bu bölümünde yurt içinden ve yurt dışından banyo seramikleri örnekleri derledik. Bu harika banyo seramik modelleri sizlere ilham verecek.

Banyo Seramik Kullanım Önerileri

Günümüzde pek çok dekorasyon trendi var. Bunların arasından evinize en uygununu seçmek için kesinlikle doğru yönlendirmelere ihtiyacınız var. Biz de bu bölümde sizlere banyo seramik seçimi ile alakalı uzmanlardan derlediğimiz önerileri sıralayacağız.

Mavi ve Beyaz Tonlar Öneriyoruz

Mavi veya beyazın tonları en risksiz banyo seramik modelleri arasında yer almaktadır. Özellikle sade bir anlayışa sahipseniz mavi ve beyaz renkleri sizler için önerebiliriz. Mavini beyaza ve yeşile yakın tonları banyonuzda güzel bir atmosfer yaratmanıza olanak tanıyabilir. Dikkat etmeniz gereken burada renklerin doğru oranlarda banyo geneline dağılımı olacaktır.

İlginizi çekebilir: Kum beyazı duvar boyası

Geometrik Şekiller Kullanın

Geometrik şekilleri tercih etmek, dekorasyonda size güç verecektir. Banyo seramikleri arasından en doğru seçimi yapmak için inceleme yaparken geometrik desenlerin olduğu seramikleri tercih edebilirsiniz.

Ahşap Görünümlü Seramikler Seçin

Ahşap bir görünüme sahip, doğal bir algı oluşturan seramikler seçebilirsiniz. Ahşap öğeler size banyonuzda huzur verecektir. Aynı zamanda ahşabın lüks algısı da bu seçimde unutulmamalıdır.

Ultra Beyaz Seramikler

Beyaz temizlik algısı uyandırır. Banyonuz için de bu algı son derece önemlidir. Ultra beyaz seçimler sizin eviniz için sizlere harika bir atmosfer sağlayabilir.

Yumuşak ve Pastel Renkler

Banyo seramikleri arasından tercih yaparken renk noktasına dikkat etmeniz gerekir. Doğru renkleri seçmek dekorasyonda da sizlere yol gösterici olacaktır. Yumuşak ve pastel renkleri seçmeniz burada banyo için ideal seçimler olabilirler.

İlginizi çekebilir: Pastel renkler

Mavi Desenleri Kullanalım

Beyaz fayansların üzerine mavi desenlerin olduğu çalışmalar dekorasyon anlamında banyoya modern bir görünüm kazandıracaktır. Mavi desenlerin olduğu seramikler sizler için güzel olabilir.

Renkli Banyo Seramikleri

Renkli banyo seramikleri banyoya enerji ve güzel atmosfer katacaktır. Sarı, mavi yeşil gibi renklerin bir arada kullanıldığı seramikleri enerji dolu bir banyo için düşünebilirsiniz.

Okyanus Yeşili Seramikler

Okyanus yeşili doğal bir görünüm kazandırır. Yeşilin banyonuzda kullanabileceğiniz en değerli tonlarından biridir. Yeşili kendi alanınız için yalnızca tek duvar üzerinde deneyebilirsiniz.

İlginizi çekebilir: Yeşil renk duvar boyası

Retro Tarzı Banyo Seramikleri

Retro tarzı seramikler günümüzde oldukça fazla bir şekilde kullanılır oldu. Banyo eşyalarınız ile uyumlu biçimde banyo seramikleri bu tarzda kullanılabilmektedir.

Bebek Mavisi Yeni Trend

Bebek mavisi rengi yaşadığımız yılların en güzel renklerinden biridir. Yeni moda olan bu rengi çocuk odası dekorasyonu, banyo dekorasyonu gibi pek çok alanda tercih edebilirsiniz.

Romantik Bir Kırmızı Deneyebilirsiniz

Banyo seramikleri seçerken farklı bir tarz güzel bir atmosfer oluşturmak istiyorsanız romantik bir kırmızı ile banyo seramikleri üzerinde çalışabilirsiniz. Bu seçimi tek duvar üzerinde veya duşakabin bölümünde deneyebilirsiniz.

Bu içeriğimizde sizlere en harika banyo seramik modelleri ve örnekleri derlemesi yaptık. Size bu doğrultuda seramik kullanım önerileri ile birlikte iç mimarlardan banyo seramikleri seçimi ile alakalı da önerileri, fikirleri sunmaya gayret ettik. Umarız sizler için faydalı ve ve ilham verici olmuştur. Siz de banyonuzu yenilemek istiyorsanız dilediğiniz an Evde Mimar ekibi ile iletişime geçebilir, soru ve görüşlerinizi istediğiniz zaman bizimle paylaşabilirsiniz.

İlgili içerik: Banyo fayans modelleri

İlgili içerik: Son yılın popülerleşen duşakabin modelleri

 

dikdortgendusakabinmodellerivekullanimi
Banyo Dekorasyonu, Banyo Modelleri, Banyo Tadilatı, Ev Dekorasyonu, Mutfak Dekorasyonu

Dikdörtgen Duşakabin Modelleri ve Kullanım Önerileri

Duşakabin şekilleri ve modelleri günümüzde banyo dekorasyonu ve banyo tadilatı için incelenmesi gereken kritik öğelerin başında geliyor. Şekiller, tasarımlar, tüm banyonun görünüşünü doğrudan etkiliyorlar. Bizler de Evde Mimar olarak sizlere banyonuzu harika bir hale getirmeniz öneriler sunarak yardımcı olmaya, sizlerin gerçekten güzel bir banyoya sahip olmanızda yanınızda olmaya çalışacağız.

Dikdörtgen Duşakabin Modelleri ve Örnekleri

Dikdörtgen duşakabinler son yıllarda trend olan duşakabin kullanımları arasında gösterilmektedir. Özellikle dikdörtgen duşakabinlerin yanına seçilen banyo fayans modelleri de bu şekle sahip duşakabinler günümüzde daha popüler olmasına ön ayak olmaktadır.

Bu bölümde sizlere banyolarda kullanılan dikdörtgen duşakabin modelleri göstermeye çalışacağız. Dünyanın dört bir yanından derlemeleri görerek sizler de kendi eviniz için ilham alabilirsiniz.

Örneklere baktığımızda bir bütünlüğün hakim olduğunu net bir şekilde görebiliriz. Aynı zamanda duşakabin fayans uyumu ve banyo armatürleri de gerçekten uyum içerisinde olduğunu net bir şekilde gözlemleyebiliriz. Sizler de evinize duşakabin seçerken veya banyo tadilatı yaptırmak istediğinizde bu dekorasyon aklını banyonun her köşesine yansıtmalı, aynı dekorasyon bakış açısı ile çalışmalarınızı dizayn etmelisiniz.

İlginizi çekebilir: Duşakabin seçim önerileri

Hangi Durumlarda Dikdörtgen Duşakabin Modelleri Kullanılır?

Dikdörtgen şeklindeki duşakabinler genel olarak sade tasarımlar söz konusu olduğunda tercih edilirler. Özellikle keskin hatlara sahip minimalist tasarımlar içerisinde dikdörtgen duşakabin modelleri ön plana çıkmaktadır. Sadeliği içerisinde barındıran bu modeller aynı zamanda klasik banyo dekorasyonları için de ideal olabilirler. Dikdörtgenin kendi içinde vermiş olduğu keskin hatlar modelin daha fazla tasarım ile uyum içerisinde çalışmasına ön ayak olmaktadır.

Banyo dekorasyonu pek çok öğenin doğru şekilde kullanılması ile elde edilir. Örneğin duşakabinler ile fayanslar doğru biçimde benzer şekilde modeller seçilerek tercih yapılmalıdır. Sizin de eğer beğendiğiniz fayans modelleri varsa duşakabin seçimini buna göre yapmalısınız.

Küçük Banyolar için Dikdörtgen Duşakabin

Dikdörtgen şekiller genel olarak iç mimari alanda kullanışlı kabul edilmezler. İç mimarlar dikdörtgen şeklinde yapıları sevmezler, tercih etmezler. Fakat söz konusu olan banyo ve duşakabin ise en kullanışlı şekillerden biri kesinlikle dikdörtgen duşakabin modelleridir. Burada model seçimi iyi bir biçimde yapılan ve aynı zamanda iyi bir renk ile birleştirilen banyolar güzel dekorasyonun simgeleri olmaktadırlar.

Dikdörtgen Duşakabin Yanında Nasıl Dekorasyon Yapılmalı?

Fayansların banyo dekorasyonunda oldukça önemli olduğunu sizlere aktarmaya çalışmıştık. Tüm banyonun görünüşünü fayans seçimleri etkilerken çevresindeki armatürleri ve duşakabinleri de etkileyecektir. Bu yüzden öncelikle hangi fayans modeli ile yola devam edeceğinizin kararını vermelisiniz. Fayans seçiminizin ardından eğer bu içeriğimizde bahsettiğimiz üzere duşakabinler ile uyum içerisinde sergilemek istiyorsanız fayanslarınızı keskin hatlara sahip büyük modeller ile kurgulayabilirsiniz.

Banyo dolaplarının beyaz olması ve duşakabin rengi ile uyum içerisinde olması Evde Mimar olarak bizlerin dikkat ettiği noktalardan biridir. Banyonuzu dizayn ederken renk uyumunun doğru biçimde yapılanması gerekir. Mavi ile beyaz, siyah ile beyaz renkler banyonuzda yumuşak tonlar yardımı ile kullanılabilirler.

Bu içeriğimizde sizlere dikdörtgen duşakabin modelleri ile birlikte kullanım örnekleri de sunmaya çalıştık. Umarız sizlere faydalı olmuşuzdur. Siz de konu ile alakalı olarak bizlere merak ettiklerinizi iletebilir, soru ve görüşlerinizi Evde Mimar ekibi ile dilediğiniz an paylaşabilirsiniz.

 

banyofayansmodelleriveornekleri
Banyo Modelleri, Banyo Tadilatı, Ev Dekorasyonu, Uygulama Örnekleri

Banyo Fayans Modelleri ve 30 Harika Fayans Önerisi

Banyolar evin en değerli alanlarından biridir. Eğer banyo güzel bir biçimde dizayn edilirse evin diğer dekorasyon gereçleri de tam olarak dekorasyona uyumlu bir şekle getirilmiş olur. Bizler de bu içeriğimizde dekorasyonunun önemli bir parçası olan banyo fayans modelleri ile birlikte sizlere öneriler sunacağımız bir içerik hazırladık. Bu yazımızı inceledikten sonra beraber banyonuzun fayanslarını seçerken çok daha rahat bir şekilde karar vereceksiniz.

boyabanner

En Güzel Banyo Fayans Modelleri

Sizlere seçtiğimiz en güzel modeller ile beraber başlamak istedik. En güzel banyo fayans modelleri bölümümüzde sizlere hem harika örnekler hem de ülkemizde de rahatlıkla bulabileceğiniz fayans önerileri sunuyor olacağız. Örnekleri incelerken kendi evinizi düşünmeli, evinizde fayansların nasıl dizayn edilebileceğini, tadilat işlemlerinin ne şekilde gerçekleşeceğini hayal etmelisiniz.

Banyo modelleri arasından en güzelini seçtiğinizde fayansın belirleyici bir özelliğe sahip olduğunu görebilirsiniz. Fayans bir mekanın tüm güzelliğini belirleyecek önemli birimlerden biridir. Bu nedenle örnekler üzerindeki etkisini iyi incelemek, eve doğru biçimde uygulamak gerekir.

Banyo için Fayans Modeli Seçim Önerileri-30 Uzman Önerisi

Banyonuzun güzelliğini belirleyecek olanın fayans seçimi olduğunu söylemiştik. Fayanslar atmosferi belirler. Bu doğrultuda da fayansların evlere göre uyumu da kritik öneme sahiptir. Bu bölümde de sizlere Evde Mimar ekibi olarak banyo için fayans modeli seçimi önerileri sunuyor olacağız.

1- Dairesel modelleri deneyin

Daire şeklindeki tasarımlar, fayanslarınıza enerji katacaktır. Banyonuzda mavi ve maviye yakın tonlar ile birlikte seçeceğiniz dairesel modeller dekorasyonunuzu güçlendirir.

2- Küçük fayans örnekleri inceleyin

Fayanslarınızı küçük bir biçimde seçerseniz farklı tonlamalar ile canlılığı yakalayabilirsiniz. Özellikle modern tarzda bir banyonuz varsa bu doğrultuda küçük fayansları tercih edebilirsiniz.

3- Sarı ile beyazın uyumunu yakalayın

Sarı ile birlikte beyaz rengin uyumunu kesinlikle yakalamalısınız. Sarı ile beyaz sadeliği simgelediği gibi sizlere minimalist bir tarz da verecektir. Bu doğrultuda size farklı bir bakış açısı ferah bir atmosfer yaratır. Eğer banyonuz geniş ise sarı ile beyaz fayansları kesinlikle incelemelisiniz.

4- Mavinin açık tonları size göre olabilir

Mavi rengi banyo fayansları üzerinde kullanmak tam da yaratıcı zekaya sahip kişilere göre bir davranıştır. Özellikle mavinin açık tonları banyoya huzur katacağı gibi banyonun tüm çehresini de değiştirir. Geniş ve farklı tarzlarda fayanslar ile birlikte mavinin tonlarını banyonuzda deneyimleyebilirsiniz.

5- Bal beteği şeklini deneyin

Bal peteği rengi farklı tarzı ile banyoya enerji verir. Fayans seçiminde farklı bir tercih yapmak istiyorsanız bal peteği görünümüne sahip fayansları tercih edebilirsiniz.

6- Deniz görünümünü düşleyin

Deniz görünümü vermek iç mimarların en fazla kullandığı dekorasyon çalışmalarının başında gelmektedir. Deniz görünümlü odalar dizayn etmek, denizi odalara yansıtmak her banyoya nasip olmayan güzel tadilat çalışmalarındandır. Siz de kendi banyonuzu deniz hissi uyandırır bir hale sokabilirsiniz.

7- 3 boyutlu epoksileri deneyin (bonus)

3 boyutlu epoksiler her ne kadar fayans modelleri dışında bir çalışma olsa da sizlere örnek sunmaya çalıştık. 3 boyutlu çalışmalar bir önceki madde de belirttiğimiz gibi deniz hissi uyandırmanızda sizlere yardımcı olacaktır.

İlgili yazımız: 3 boyutlu epoksi zemin kaplama

8- Mavi boya ile küçük mavi fayans uygulamaları

Mavi duvar boyası ile birlikte fayanslarınızı bir ton açığı ile dizayn etmek dekorasyon gücünüzü arttırabilir. Burada küçük boyutta fayansları tercih ederseniz çok daha iyi sonuçlar alabilirsiniz.

9- Sade ve düz fayanslar minimalist sevenlere gelsin

Minimal tarzda dekorasyonlardan hoşlanıyorsanız sade ve düz fayanslar sizin için harika olabilir. Özellikle geniş ve boyutu büyük fayansları banyonuzda tercih edebilirsiniz.

10- Fas tarzı çiçek desenlerini banyonuzda kullanabilirsiniz

Fas ülkesinin vermiş olduğu o otantik tarzı evinizde yansıtabilirsiniz. Fas tarzı çiçek desenleri de fayanslarınıza yansırsa otantik bir banyo sizin için dizayn edilmiş olacaktır.

11- Griyi fayanslarınıza yansıtabilirsiniz

Gri renk son yılların en trend renkleri arasında yer almaktadır. Özellikle grinin birçok renk ile birlikte uyum içerisinde çalışması da rengin bu denli popüler olmasına ön ayak olmaktadır. Gri fayanslar da bu dönemde aynı nedenden ötürü hayatımıza güçlü bir biçimde etki etmeye başlamaktadır.

12- Çiçeklerin gücüne inanın

Bir çiçek insan ruhunu bile değiştirebilme gücüne sahipken banyonuzun atmosferini neden değiştirmesin ki, çiçekler güçlü nesnelerdir. Çiçekleri evinizin her yerinde kullanabileceğiniz gibi fayans üzerindeki desenlerde de tercih edebilirsiniz.

13- Gümüşün tonları asalet taşır

Gümüş rengini banyo fayans modelleri üzerinde değerlendirmek evinizin dekorasyonuna asalet katacaktır. Asil bir görünüm ve lüks bir izlenim kazandıracaktır. Bu nedenle siz de kendi evinizde gümüş tonlarını deneyimleyebilirsiniz.

14- Desenler tarz katar

Desenleri doğru şekilde kullanırsak evimizi tamamen güzelleştirmiş oluruz. Eğer evimizi, banyomuzu gerçekten dekore etmek istiyorsak desenleri iyi bir şekilde kullanmalıyız. Fayans içerisinde seçeceğimiz desenler de bu tercihlerin başlangıç noktalarını oluşturacaklardır.

15- Çapraz çizgili fayansları deneyebilirsiniz

Çapraz desenlere sahip ve çapraz çizgileri olan fayanslar eğer doğru renkler tercih edilirse gerçekten fark yaratan detaylar olabilirler. Bu nedenler çapraz özelliklere sahip fayanslara tekrar bir göz atmalısınız.

16- Büyük kareler düşleyin

Kareleri yalnızca fayansların içerisinde düşlemeniz gerekmez. Büyük resmi görerek banyonuzu karelere bölerek kolayca değiştirebilirsiniz. Dekorasyonunuzu tüm bu hamleler gerçekten güçlendirecektir.

17- Siyah ile beyazın uyumuna şahit olun

Siyah ile beyaz rengi evinizin pek çok yerinde doğru oranda kullanabilirsiniz. Fayans seçiminde de aynı detay söz konusudur. Eğer doğru biçimde sizi tatmin edecek ölçüde beyaz rengi siyah ile birlikte kombinlersek gerçekten başarılı bir çalışma yapmış olursunuz.

18- Beyaz ile kahverengiyi de deneyebilirsiniz

Eğer küçük bir banyonuz varsa çok tavsiye etmediğimiz bu fayans modeli için banyonuzda lüks bir görünüm istiyorsanız gerçekleştirebileceğiniz bir dekorasyon tarzı olarak düşünebilirsiniz.

19- Büyük boyut dekorasyon getirir

Büyük boyutları kullanmak evinize dekorasyon getirebilir. Banyonuz içerisinde de fayanslarınızı büyük bir şekilde tercih ederek, banyo fayans seçiminizde iyi bir tercih yapabilirsiniz. Bununla birlikte 2 metre x  1,50 şeklindeki modelleri de deneyebilirsiniz.

20- Zemin farklı duvar farklı

Zemin ile duvarın farklı renklerdeki ve farklı modellerdeki fayanslar ile döşenmesi dekorasyon aklının işaretidir. Eğer sizler de kendi banyonuzda doğru şekilde uyum ve renk tonu farklılıklarına dikkat ederek zemin-duvar fayans ayrımını gerçekleştirirseniz güzel bir dekorasyon adına ilk adımları atmış olursunuz.

21- Geometriyi ihmal etmeyin

Geometriyi iyi bir şekilde banyonuza yansıtırsanız çok güzel bir dekorasyon elde edebilirsiniz. Geometrik fayanslar da bunun temel noktalarıdır. Dairesel, üçgen ve dikdörtgen fayansları banyonuzda deneyebilirsiniz.

22- Ağaç efekti ile doğallığı yakalayabilirsiniz

Ağaç efekti veren fayanslar ile doğal bir banyo görünümüne kavuşabilirsiniz. Burada tüm dekorasyon aklının aynı doğrultuda çalışmasına dikkat etmelisiniz. Ağaç efekti banyonuzu güçlendirecek sizi de gerçekten iyi hissettirecektir.

23- Yeşili harmoni edin

Yeşilin tonları aynı mavinin tonlarında olduğu gibi size ve banyonuzun atmosferine rahatlık, huzur katar. Yeşilin beyaz ile uyumunu simgeleyen fayansları sizler de bu doğrultuda seçebilirsiniz.

24- Desenleri beyaz olsun

Banyo fayans modelleri yüzlerce çeşit olabilir fakat bunların arasından sizlere önereceğimiz kesinlikle beyazın motif olarak kullanıldığı modeller olacaktır. Bu modeller size güçlü bir dekorasyon için ilham olur.

25- Pastel renkler her yerde

Geleceğin dekorasyonlarına baktığımızda pastel renklerin son derece hakim olacağını sezebiliriz. Banyo fayans modelleri seçerken de pastel renkler hakim kılınmalı, yumuşak ve huzur verici bir ortam yaratılmalıdır.

26- Desenli mavi, atmosfer katar

Banyonuzda atmosfer olsun, evin diğer bölümlerinden ayrılsın diyorsanız desenli mavi fayans türleri tam size göre olabilir. Evinizin dekorasyon aklı ile uyumlu bir biçimde seçeceğiniz fayanslar mavi niteliğe sahip desenler ile bezenirse hem otantik hem de dekoratif bir görünümü banyonuzda gözlemleyebilirsiniz.

27- Çok renkli seçenekler enerji katar

Banyo fayansları tek renk olmak zorunda değildir. Fayansların gücünü renklerin gücü ile birleştirerek sizler de evinizde gerçekten harika bir atmosfer yaratabilirsiniz. Çok renkli seçeneklerin bulunduğu fayans modelleri sizlerin de ihtiyacınızı tam olarak karşılayacaktır.

28- Açık yeşil, tam ekran olabilir

Açık yeşili banyonuzun tümüne tek düze bir biçimde uygulayabilirsiniz. Tek renk olarak da beyaz ile uyumlu olarak da kullanılan açık yeşil banyonuzun atmosferini ferah verici bir hale getirecektir.

29- Retro mavi şahanedir

Retro tarzı severlere duyurulur, mavinin retro tarzı ile fayanslarınızı seçebilirsiniz. Özellikle şekil burada kritik noktadır. Geometrinin o en eski en nostaljik tonlarını kullanarak retro bir görünüm elde edebilirsiniz.

30- Rustik fayans seçeneklerini düşünebilirsiniz

Rustik tarzı seviyor ve evinizde uygulamayı düşünüyorsanız bunu fayanslarınızda da yansıtabilirsiniz. Fayanslarınızın hem rengini hem de şeklini rustik adı verilen bu akıma uyarak seçebilir, banyonuzu bu şekilde dizayn edebilirsiniz.

İlgili yazımız: Fayans boyama

Bu içeriğimizde sizlere banyo fayans modelleri ile alakalı bilgiler vermeye çalıştık. Umarız sizler için faydalı olmuştur. Siz de konu ile alakalı olarak bildiklerinizi bize aktarabilir, fayans seçimi konusunda sorularınızı bize yöneltebilirsiniz. Tüm bunlar ile birlikte evinize fayans uygulaması yaptırmak istiyorsanız bizimle iletişime geçebilir, soru ve görüşlerinizi bize dilediğiniz an aktarabilirsiniz. Güzel fayanslar ile birlikte evinizde gerçekten mutlu bir biçimde yaşamanız dileğiyle, mutlu ve dekorasyon dolu kalın.

İlgili içerik: Banyo dolap modelleri

duşakabin seçerken nelere dikkat edilmeli?
Banyo Dekorasyonu, Banyo Modelleri, Banyo Tadilatı, Ev Dekorasyonu, İç Mimarlık

Duşakabin Seçerken Nelere Dikkat Edilmeli?

Yaşantımızı sürdürdüğümüz evlerimizde şıklığı ve kullanılabilirliği ayrılmaz bir bütün olarak düşünmekteyiz. Özellikle banyolarda diğer alanlara göre dekoratif objelere daha az ihtiyaç duyuyoruz banyo malzemeleri başlı başına bir dekor ürünü özelliği taşımalı ve göze hitap etmeli ve kullanışlı olmalı peki bunlar bir bütünün parçaları nasıl olmalı?

Duşakabin Alanınızı iyi kullanmalısınız

Öncelikle banyo dekorasyonu yaparken alanınızı iyi kullanmalısınız bunun içinde banyo ölçülerinizi bilmeli ve buna göre hareket etmelisiniz yoksa duşakabin konunmlandırmak istediğiniz alana küçük ya da büyük gelebilir bu ölçüler alankara göre farklılık gösterebilir
arada nasıl olmalı işte maddeler halinde yapılması gerekenler:

Duşakabin modelleri içerisinde kapı açma sistemi

Duşakabinlerde boyut kadar kapı açılma türleride önemli yer tutmaktadır genel duşakabin türleri : tek, iki ve üç duvar arasında konumlandırılacak şekilde sınıflara ayrılabilir. İki duvar duşakabinler, evlerde en çok kullanılan, genellikle evin köşesine konumlandırılan ve kabinin, iki duvarı içine aldığı çeşittir. Tek duvar duşakabinler ise genellikle köşeye monte edilmezler. Bu tip kabinlerin çoğunlukla duvarın bir bölümünü içerisine alır ve bataryalar ile duş setleri de bu alana monte edilir. Tek duvar ve iki duvar duşakabinlerde aynı kapı açılış şekilleri kullanılabilir.

Tam Dönebilir: Ev kapıları gibi tam olarak açılan kapılardır. Açılış yönü, alana ve tercihe göre belirlenebilir.
Yarım Dönebilir: Ev kapıları gibi açılan kapılardır, fakat yarım bir şekilde açılıp erişime izin verirler. Açılış yönü alana ve tercihe göre belirlenebilir.
Tek veya Çift Panelli Sürgülü Kapı: Sürgülü kapı/kapılar çekilerek duşakabine girilir. Tek yöne sürülen bir kapı ya da hem sağa hem de sola sürülen iki kapı yani panelden oluşabilir.
Kare Köşeden Erişim: Sürgülü panelin köşede bulunduğu duşa kabin kapı seçeneğidir.
Oval: Giriş panelinin oval olduğu sürgülü kapı seçeneğidir.
Bar Kapıları: Hem ileri hem de geri oynatılarak duşakabine girmeye ya da çıkmaya imkân veren kapı türüdür.
Katlanır Panel: Kapının katlanabildiği alternatiftir. Tek ya da çift panel olabilir.
Walk-in Panel: Bir küvetin ya da zeminin üzerine ve profillere sabitlenebilen tek cam paneldir. Duşakabinin bir tarafında kapı ya da camın bulunmadığı bu seçenek, direkt girişe imkân verir. Eğer bu seçeneği tercih edecekseniz banyonuzun ve duşakabin teknenizin yeterli büyüklükte olmasına dikkat etmelisiniz.

Duşakabin ile Banyo Dekorasyonu Nasıl Yapılır?

Duşakabin modelleri banyoların çok daha özenli ve şık görünmesini sağlayan temel unsurlardan biridir ve ayrıca mahremiyet konusunda’da oldukca önemlidir özellikle buzlu ya da desenli kabinlerle kişiye mahremi bir alan vermekte aynı anda banyoyu farklı birininde kullanmasına olanak sağlamaktadır peki banyo düzenlemesinde duşakabinin önemi nedir:

Duşakabin boy ebatları nelerdir?

Duşakabin boyutları banyo boyutları için hayati önem taşımaktadır dar banyolar için kare yapıda çift kapılı duşakabin başlıkları yerine oval yapılı başlıkları tercih etmek alan kullanımı açısından çok daha kullanışlı olmaktadır

Duşakabin için renk kullanımı nasıl olmalı?

Boy ve ebatlar kadar banyo dekoruna etki eden önemli etkenlerden biride hiç kuşkusuz duşakabin renkleri eğer banyo dekorunda koyu tonlar ağırlıktaysa duşakabin renkleri parlak ve canlı olmamalı bu göz hitabetine ters bir dekorasyon, banyo dekorasyonu örneğidir yine aynı şekilde duşakabin sürgülerinde paslanmaz çelik kullanmak malzeme kalitesini artırarak daha uzun bir kullanım ömrü sağlar.

İlginizi çekebilir: Son yılın popülerleşen duşakabin modelleri

Duşakabin zemini nasıl olmalı?

Duşakabin zemin üzerine oturtulurken muhakkak yerden belli bir yüksekliğe konuçlandırılmalıdır eğer istenilen yükseklik verilmezse giderde oluşacak en ufak bir birikme durumunda zemine yayılma yapabilir. Bunun için cam tuğla ile yaklaşık 5 cm.bir yükseklik ideal yüksekliği temin etmektedir,ayrıca seramik kaplamasına dikkat edilmelidir seramik su geçirmez kaplama ile kaplanmalıdır aksi halde kaymalar oluşabilmektedir. Ve aynı şekilde zemine verilen yükseklikte silikon kullanımı önemli yer tutmaktadır. eğer su ile çok temas ederse kararmalar meydana gelebilir.

İlginizi çekebilir: Duşakabin modelleri

 

 

banyomodelleriveornekyazisi
Banyo Modelleri, Banyo Tadilatı, Ev Dekorasyonu

İlham Alınacak Banyo Modelleri 35 Harika Modern Örnek

Banyo tasarımları ve banyo çalışmaları ev sahiplerinin heyecan duyarak gerçekleştirdiği ev tadilatı bölümlerinden biridir. Özellikle ülkemizde onlarca markanın yüzlerce modeli de bu heyecanı körüklemekte hayal kurulan ve ev sahipleri tarafından istenen modeller, çalışmalar ortaya çıkmaktadır. Bizler de bu içeriğimizde sizler için en güzel modelleri derlemeye ve sizlere sunmaya çalışacağız.

Eviniz için İlhamlık Banyo Modelleri

İlham almak ev dekorasyonu söz konusu olunca en can alıcı kelimedir. Farklı banyo modelleri incelemek de ilham almanıza yardımcı olabilecek özelliklere sahiptir. Evde Mimar ekibi olarak bizler de bu düşünce ile harika derlemeler gerçekleştirdik. Aşağıda farklı farklı banyo modelleri ile eviniz için siz de fikirler edinebilir, hayallerinize gerçeklik katabilirsiniz.

Modern Banyo Modelleri

Modeller kendi içerisinde pek çok kategoriye ayrılmaktadır. Modern banyo modelleri ide bu kategorilerin en çok merak edilen alanını oluşturmaktadır. Özellikle yeni evlerin pek çoğu modern banyo modelleri ile dizayn edilmektedir. Bu bölümde de sizler için derlemelerimizi bu kategori özelinde gerçekleştirdik. Umarız beğenirsiniz.

Fayanssız Banyo Modelleri

Fayans olmadan banyo olmaz demeyin. Modern dünyada modern dekorasyonlarda fayanssız banyo modelleri de trend olma özelliklerini koruyorlar. Özellikle sadelik anlayışı ile birlikte bu trendin önümüzdeki yıllarda da devam edeceğine kesin gözü ile bakıyoruz. Banyonuzun tadilatı yapılmadan önce bu örnekleri incelemek sizlere de faydalı olacaktır.

Döşenmiş Banyo Modelleri

Döşenmiş banyo modelleri model incelemesi yapan herkesin gerçekten istediği çalışmalardan biridir. Özellikle eviniz banyonuz küçükse ve nasıl dekore edeceğinizi bilemiyorsanız hazır banyo modelleri de sizlerin taleplerine cevap verebilir. Bu bölümde sizlere döşenmiş banyo modelleri sunarak yardımcı olmaya, hayalleriniz doğrultusunda sizlere yardımcı olmaya çalışacağız.

Hangi Banyo Modeli Tercih Edilmeli?

Banyo modelleri arasından seçim yapmak oldukça önemli süreci temsil ediyor. Evinizin nasıl görüneceğini, en mutlu olduğunuz bölümlerden biri olan banyolardaki dekorasyonların nasıl güzel durduğunu sizler de görebilirsiniz. Bu noktada hayal edilen bir banyoya sahip olmak için öncelikle evin tüm dekorasyonu dikkate alınarak seçimler yapılmalı. Modern tarzda bir eve sahipseniz modern banyo modelleri incelemelisiniz. Dekorasyon aklının ardından banyonuzun boyutunun ne ölçüde olacağını tespit etmeniz gerekiyor. Banyo boyutu sizlerin hayallerinin sınırlarını çizecektir. Eğer küçükse büyük gösterecek hamleler yapmalısınız. Seçeceğiniz modeller üzerinde de tarzınıza uygunluk esas olmalıdır. Sadece güzel gözüküyor diye banyo dizayn edilmez. Sizin tarzınıza en uygun seçenekleri göz önüne almalısınız. Rahatlığınız, yaşam tarzınız banyoya yansımalıdır. Seçimlerinizi yaparken bu etmenleri göz önünde bulundurarar bir tercih yapmalısınız.

Banyo Tadilatı Yapılmadan Önce

Banyo tadilatı yaptırmadan önce araştırmalara ve örneklere iyi göz atmak gerekir. Özellikle farklı bir tasarım isteyen ev sahipleri için yurt dışındaki örnek tasarımları incelemek ilham olacaktır. Yukarıdaki örnekleri incelemenin yanında merak ettiğiniz konuları da banyo tadilatı fiyatları sayfamızdan öğrenebilir, soru ve görüşlerinizi dilediğiniz an Evde Mimar ekibine iletebilirsiniz.

Tadilat yaptırmadan önce malzeme kullanımını seçmelisiniz. Hangi marka ile yola çıkacağınızı evinizi hangi marka ile güzelleştireceğinizi belirlemeniz gerekir. Bizler de bu doğrultuda sizlere yardımcı olmak için ücretsiz destek veriyoruz. İsterseniz iç mimarlar ile online keşif yapabilirsiniz.

Banyo ile Ev Dekorasyonu İlişkisi

Banyo ev dekorasyonunun temel taşlarından biridir. Eğer evin temel dekorasyon aklı ile banyonun temel dekorasyon ihtiyaçları uyuşuyorsa doğru bir şekilde tercih yapılmış demektir. Modern tarz, klasik tarz, country tarzı gibi seçimler bütünlük göstermeli, tüm seçimlerin banyo ile ev dekorasyonu ilişkisi göz edilerek yapılması gerekmektedir.

Gelecekte Banyo Modelleri Nasıl Olacak?

Gelecek eskiye göre günümüzde çok daha hızlı bir şekilde geliyor. 5 yıl öncesindeki evler ile şimdiki evlerin dahi akıl anlamında birçok farkı var. Günümüzde daha akıllı evler, teknolojiyi daha iyi kullanan evler var. Bu nedenle evlerin gerçekten bizlere göre dizayn edilmesi, yaşamımıza kalite katması ve hayatımızı kolaylaştırması gün ve gün gerçekleşiyor. Gelecekte de durum çok fazla değişmeyecek, teknoloji her tarafımızı sararak bizlere yardımcı olmak için kendini geliştirmeye devam edecek. En yeni nesil banyo örneklerini buradan inceleyebilirsiniz.

Sanal gerçeklik banyo modelleri üzerinde kendini göstermeye devam edecek. Tüm bunların yanında sanal gerçekliği çok iyi kullanan dekorasyon firmaları da bir adım öne çıkabilecekler. İç mimari çalışmalar artık çok daha gerçekçi olacaklar.

Dekorasyon aklı olarak geleceğe doğru baktığımızda banyo modelleri arasında sadeliğin ve minimalizm akımının çok daha ön plana çıkacağını düşünüyoruz. Bilişsel yük kavramının bu derece fazla olduğu günümüzde banyoların da sade ve huzur verici olacağını bekliyoruz. Özellikle beyaz renk kullanımının artacağını ve gelecekte beyaz ile sadeliğin yakalanacağını ön görüyoruz.

Bu içeriğimizde sizlere banyo modelleri ile ilgili bilgiler vermeye çalıştık. Umarız sizler için faydalı olmuştur. Siz de evinizi güzelleştirmek, banyonuzu değiştirmek istiyorsanız bizimle iletişime geçebilir, Evde Mimar ekibi ile dilediğiniz an irtibat kurabilirsiniz.

İlginizi çekebilir: Banyo dolap modelleri

 

Boya Badanada
%15 İndirim
Evde Mimar ile Türkiye'nin her yerinde profesyonel ustalarla 1 yıl garantili, hızlı ve uygun fiyata evinizi boyatabilirsiniz.
Sizi Arayalım
close-link
Evinizin boya badana ve tadilat işleri için...

Telefonunuzu bırakın sizi arayalım

Sizi anlayabilen profesyonel ustalar ile 1 yıl garantili bir şekilde evinizi boyatmanın şimdi tam zamanı!
GÖNDER
close-link
Sizi Arayalım
Eviniz ile ilgili boya badana ve tüm tadilat işlemleriniz için sizi arayalım, evinizi güzelleştirelim.
Gönder